Antibodies

View as table Download

UPP2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 217-244 amino acids from the C-terminal region of human UPP2

Rabbit polyclonal Anti-Upp2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Upp2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SREIPNVPTLIGHTMCTYDFYEGQGRLDGALCSFSREKKLDYLKRAYRAG

Rabbit Polyclonal Anti-UPP2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human UPP2

UPP2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human UPP2