Rabbit Polyclonal Anti-ABHD15 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ABHD15 antibody: synthetic peptide directed towards the N terminal of human LOC116236. Synthetic peptide located within the following region: QTLCHFVLPVAPGPELAREYLQLADDGLVALDWVVGPCVRGRRITSAGGL |
Rabbit Polyclonal Anti-ABHD15 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ABHD15 antibody: synthetic peptide directed towards the middle region of human LOC116236. Synthetic peptide located within the following region: LLALERGYYPVIFHRRGHHGCPLVSPRLQPFGDPSDLKEAVTYIRFRHPA |
Germany
Japan
United Kingdom
China