Antibodies

Jump to Filters
View as table Download
AIG1 Rabbit Polyclonal Antibody
TA315474

USD 345.00

In Stock

Rabbit polyclonal anti-AIG1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AIG1
AIG1 Rabbit Polyclonal Antibody
TA319923

USD 430.00

5 Days

Rabbit Polyclonal AIG1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen AIG1 antibody was raised against a 17 amino acid synthetic peptide near the amino terminus of human AIG1.
Aig1 Rabbit Polyclonal Antibody
TA337973

USD 375.00

5 Days

Rabbit Polyclonal Anti-Aig1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Aig1 antibody is: synthetic peptide directed towards the middle region of Mouse Aig1. Synthetic peptide located within the following region: AVFFGICVLTDLSSLLTRGSGNQEQERQLRKLISLRDWTLAVLAFPVGVF