Rabbit polyclonal anti-ASF1B antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ASF1B. |
Rabbit polyclonal anti-ASF1B antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ASF1B. |
Rabbit Polyclonal Anti-ASF1B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ASF1B antibody: synthetic peptide directed towards the middle region of human ASF1B. Synthetic peptide located within the following region: YHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFH |
ASF1B Antibody - middle region
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of rat ASF1B |
ASF1B Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 63-202 of human ASF1B (NP_060624.1). |
Modifications | Unmodified |