Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-B3GNT6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-B3GNT6 antibody is: synthetic peptide directed towards the C-terminal region of Human B3GNT6. Synthetic peptide located within the following region: CSGGGFLLSGLAPSGHEGIRPFGVQLPGAQQSSFDPCMYRELLLVHRFAP |
B3GNT6 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 30-200 of human B3GNT6 (NP_619651.3). |
| Modifications | Unmodified |
B3GNT6 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 30-200 of human B3GNT6 (NP_619651.3). |
| Modifications | Unmodified |
Active filters
Target Symbol
- B3GNT6
Antibody Hosts
- Rabbit