Rabbit Polyclonal Anti-BATF3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | BATF3 antibody was raised against a 16 amino acid peptide near the amino terminus of human BATF3. The immunogen is located within the first 50 amino acids of BATF3. |
Rabbit Polyclonal Anti-BATF3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BATF3 antibody: synthetic peptide directed towards the N terminal of human BATF3. Synthetic peptide located within the following region: MSQGLPAAGSVLQRSVAAPGNQPQPQPQQQSPEDDDRKVRRREKNRVAAQ |
BATF3 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-127 of human BATF3 (NP_061134.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
