Germany
Japan
United Kingdom
China
Antibodies
View as table Download
CTRP1 (C1QTNF1) (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human C1QTNF1 |
Rabbit Polyclonal CTRP1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | CTRP1 (IN) antibody was raised against a 16 amino acid peptide from near the center of human CTRP1. |
Rabbit Polyclonal Anti-C1QTNF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C1QTNF1 antibody: synthetic peptide directed towards the N terminal of human C1QTNF1. Synthetic peptide located within the following region: YPATAVPQINITILKGEKGDRGDRGLQGKYGKTGSAGARGHTGPKGQKGS |
C1QTNF1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human C1QTNF1 |
Active filters
Target Symbol
- C1QTNF1
Antibody Hosts
- Rabbit