Rabbit Polyclonal CTRP7 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CTRP7 antibody was raised against a 15 amino acid peptide from near the carboxy-terminus of human CTRP7. |
Rabbit Polyclonal CTRP7 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CTRP7 antibody was raised against a 15 amino acid peptide from near the carboxy-terminus of human CTRP7. |
Rabbit Polyclonal CTRP7 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CTRP7 antibody was raised against a 15 amino acid peptide from near the amino terminus of human CTRP7. |
Rabbit Polyclonal CTRP7 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Rabbit anti-CTRP7 polyclonal antibody was raised against recombinant human CTRP7. |
Rabbit Polyclonal Anti-C1QTNF7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-C1QTNF7 antibody: synthetic peptide directed towards the middle region of human C1QTNF7. Synthetic peptide located within the following region: SIVLKSAFSVGITTSYPEERLPIIFNKVLFNEGEHYNPATGKFICAFPGI |
C1QTNF7 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 24-190 of human C1QTNF7 (NP_001128642.1). |