Antibodies

Jump to Filters
View as table Download
DULLARD (CTDNEP1) (Center) Rabbit Polyclonal Antibody
AP51335PU-N

USD 450.00

2 Weeks

DULLARD (CTDNEP1) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 131-160 amino acids from the Central region of human DULLARD
DULLARD (CTDNEP1) Rabbit Polyclonal Antibody
TA341969

USD 375.00

5 Days

Rabbit Polyclonal Anti-DULLARD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DULLARD antibody: synthetic peptide directed towards the middle region of human DULLARD. Synthetic peptide located within the following region: HPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVLSRNLHQHRLW