DULLARD (CTDNEP1) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 131-160 amino acids from the Central region of human DULLARD |
DULLARD (CTDNEP1) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 131-160 amino acids from the Central region of human DULLARD |
Rabbit Polyclonal Anti-DULLARD Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DULLARD antibody: synthetic peptide directed towards the middle region of human DULLARD. Synthetic peptide located within the following region: HPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVLSRNLHQHRLW |