Antibodies

Jump to Filters
View as table Download
DDX6 (Center) Rabbit Polyclonal Antibody
AP51226PU-N

USD 450.00

2 Weeks

DDX6 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 354~384 amino acids from the Central region of Human DDX6.
DDX6 Rabbit Polyclonal Antibody
TA341566

USD 375.00

5 Days

Rabbit Polyclonal Anti-DDX6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DDX6 antibody: synthetic peptide directed towards the N terminal of human DDX6. Synthetic peptide located within the following region: CLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYL
DDX6 Rabbit Polyclonal Antibody
TA341567

USD 310.00

5 Days

Rabbit Polyclonal Anti-DDX6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DDX6 antibody: synthetic peptide directed towards the N terminal of human DDX6. Synthetic peptide located within the following region: KTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQ
Ddx6 Rabbit Polyclonal Antibody
TA363058

USD 360.00

5 Days

DDX6 Antibody - N-terminal region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of mouse DDX6
DDX6 Rabbit Polyclonal Antibody
TA375408

USD 220.00

3 Weeks

DDX6 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 400 to the C-terminus of human DDX6 (NP_001244120.1).
Modifications Unmodified