Rabbit Polyclonal Anti-DHX34 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DHX34 antibody: synthetic peptide directed towards the middle region of human DHX34. Synthetic peptide located within the following region: VPGRLFPITVVYQPQEAEPTTSKSEKLDPRPFLRVLESIDHKYPPEERGD |
Rabbit Polyclonal Anti-DHX34 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DHX34 antibody: synthetic peptide directed towards the middle region of human DHX34. Synthetic peptide located within the following region: APQDGPPGAEEAALETLQKTSVLQRPYHCEACGKDFLFTPTEVLRHRKQH |
Germany
Japan
United Kingdom
China