Antibodies

Jump to Filters
View as table Download
EAPP Rabbit Polyclonal Antibody
TA344860

USD 475.00

5 Days

Rabbit Polyclonal Anti-EAPP Antibody - N-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Eapp antibody is: synthetic peptide directed towards the N-terminal region of Rat Eapp. Synthetic peptide located within the following region: PALSSSEDEVDVLLHGTPDQKRKLIRECLTGESESSEDEFEKEMEAELNS
EAPP (C-term) Rabbit Polyclonal Antibody
AP51354PU-N

USD 450.00

2 Weeks

EAPP (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 203-233 amino acids from the C-terminal region of human EAPP
EAPP Rabbit Polyclonal Antibody
TA362767

USD 360.00

5 Days

EAPP Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human EAPP