Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-EGR3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human EGR3 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-EGR3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-EGR3 Antibody: synthetic peptide directed towards the middle region of human EGR3. Synthetic peptide located within the following region: HIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQKEKKAEKGGAPSAS |
Rabbit Polyclonal Anti-EGR3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-EGR3 Antibody: synthetic peptide directed towards the middle region of human EGR3. Synthetic peptide located within the following region: ALPPYSNCGDLYSEPVSFHDPQGNPGLAYSPQDYQSAKPALDSNLFPMIP |
EGR3 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
Rabbit polyclonal anti-EGR3 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human EGR3. |
Rabbit Polyclonal Anti-EGR3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGR3 antibody: synthetic peptide directed towards the N terminal of human EGR3. Synthetic peptide located within the following region: LFSGSSDSVVHYNQMATENVMDIGLTNEKPNPELSYSGSFQPAPGNKTVT |
Rabbit Polyclonal Anti-EGR3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGR3 antibody: synthetic peptide directed towards the middle region of human EGR3. Synthetic peptide located within the following region: FCGRKFARSDERKRHAKIHLKQKEKKAEKGGAPSASSAPPVSLAPVVTTC |
EGR3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human EGR3 (NP_004421.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- EGR3
Antibody Hosts
- Rabbit