Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-Fra 2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Fra 2 Antibody: A synthesized peptide derived from human Fra 2 |
Antibodies
View as table Download
Rabbit polyclonal FOSL2 Antibody (C-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FOSL2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 220-248 amino acids from the C-terminal region of human FOSL2. |
Rabbit Polyclonal anti-FOSL2 antibody
| Applications | IHC, WB |
| Reactivities | Human, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOSL2 antibody: synthetic peptide directed towards the middle region of human FOSL2. Synthetic peptide located within the following region: PMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPISIAGGFY |
Rabbit Polyclonal anti-FOSL2 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOSL2 antibody: synthetic peptide directed towards the middle region of human FOSL2. Synthetic peptide located within the following region: KLQAETEELEEEKSGLQKEIAELQKEKEKLEFMLVAHGPVCKISPEERRS |
FOSL2 rabbit polyclonal antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human FOSL2 |
FRA2 Rabbit monoclonal Antibody
| Applications | IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- FOSL2
Antibody Hosts
- Rabbit