Antibodies

Jump to Filters
View as table Download
HARS1 Rabbit Polyclonal Antibody
TA313996

USD 345.00

In Stock

Rabbit polyclonal anti-HARS antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human HARS.
HARS1 Rabbit Polyclonal Antibody
TA343149

USD 375.00

5 Days

Rabbit Polyclonal Anti-HARS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HARS antibody: synthetic peptide directed towards the N terminal of human HARS. Synthetic peptide located within the following region: FVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETL
HARS1 Rabbit Polyclonal Antibody
TA376922

USD 220.00

3 Weeks

HARS Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human HARS (NP_002100.2).
Modifications Unmodified