HTR3B rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HTR3B |
HTR3B rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HTR3B |
Rabbit Polyclonal Anti-HTR3B Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HTR3B antibody: synthetic peptide directed towards the N terminal of human HTR3B. Synthetic peptide located within the following region: PLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKAT |
Rabbit polyclonal Anti-5-Hydroxytryptamine Receptor 3B (extracellular)
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)HIRQSSAGDFAQIR, corresponding to amino acid residues 213-226 of rat 5-Hydroxytryptamine Receptor 3B (Accession Q9JJ16). Extracellular, N-terminus. |
Rabbit Polyclonal Anti-HTR3B Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HTR3B |
HTR3B Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 22-238 of human HTR3B (NP_006019.1). |
Modifications | Unmodified |