Antibodies

View as table Download

KCNA7 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNA7

Rabbit polyclonal Anti-KV1.7

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Peptide TTRKAQEIHGKAPG(C), corresponding to amino acid residues 2-15 of mouse KV1.7. Intracellular, N-terminus.

Rabbit Polyclonal Anti-KCNA7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNA7 antibody: synthetic peptide directed towards the C terminal of human KCNA7. Synthetic peptide located within the following region: GEEAGMFSHVDMQPCGPLEGKANGGLVDGEVPELPPPLWAPPGKHLVTEV

Rabbit Polyclonal Anti-KCNA7 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNA7