Germany
Japan
United Kingdom
China
GIRK1 (KCNJ3) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to amino acids 150-200 of Human KIR3.1. |
Antibodies
View as table Download
Rabbit polyclonal antibody to GIRK1 (potassium inwardly-rectifying channel, subfamily J, member 3)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 248 and 501 of GIRK1 (Uniprot ID#P48549) |
Rabbit polyclonal Anti-Kir3.1 (GIRK1)
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GST fusion protein with sequence LQRISSVPGNSEEKLVSKT TKMLSDPMSQSVADLPPKLQKMAGGPTRMEGNLPAKLRKM NSDRFT, corresponding to residues 437-501 of mouse GIRK1, (MW: 34 kDa.). Intracellular, C-terminus. |
Rabbit Polyclonal Anti-KCNJ3 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | KCNJ3 / GIRK1 antibody was raised against synthetic 16 amino acid peptide from internal region of human KCNJ3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Bovine, Horse, Pig, Guinea pig (100%); Turkey, Chicken, Platypus (94%); Bat (88%); Xenopus, Stickleback (81%). |
Kcnj3 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
KCNJ3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human KCNJ3 (NP_002230.1). |
| Modifications | Unmodified |
KCNJ3 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human KCNJ3 (NP_002230.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- KCNJ3
Antibody Hosts
- Rabbit