Antibodies

View as table Download

KCNJ8 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 4-33 amino acids from the N-terminal region of human KCNJ8

Rabbit polyclonal Anti-Kir6.1

Applications IHC, WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Peptide (C)KRNSMRRNNSMRRSN, corresponding to amino acid residues 382-396 of rat Kir6.1. Intracellular, C-terminal part.

Rabbit Polyclonal Anti-KCNJ8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNJ8 antibody: synthetic peptide directed towards the middle region of human KCNJ8. Synthetic peptide located within the following region: EKPSILIQTLQKSELSHQNSLRKRNSMRRNNSMRRNNSIRRNNSSLMVPK