Antibodies

Jump to Filters
View as table Download
Lefty (LEFTY1) Rabbit Polyclonal Antibody
TA340191

USD 375.00

5 Days

Rabbit Polyclonal Anti-LEFTY1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LEFTY1 antibody: synthetic peptide directed towards the N terminal of human LEFTY1. Synthetic peptide located within the following region: MQPLWLCWALWVLPLASPGAALTGEQLLGSLLRQLQLKEVPTLDRADMEE
Lefty (LEFTY1) Rabbit Polyclonal Antibody
TA377988

USD 220.00

3 Weeks

LEFTY1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 77-366 of human LEFTY1 (NP_066277.1).
Modifications Unmodified
LEFTY1 Rabbit Polyclonal Antibody
TA384657

USD 380.00

4 Weeks

LEFTY Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from the C-terminal region of human LEFTY1/LEFTY2. AA range:301-350