Antibodies

Jump to Filters
View as table Download
MAN1A2 Rabbit Polyclonal Antibody
TA341856

USD 375.00

5 Days

Rabbit Polyclonal Anti-MAN1A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAN1A2 antibody: synthetic peptide directed towards the middle region of human MAN1A2. Synthetic peptide located within the following region: FALGADGSRADKAGHYLELGAEIARTCHESYDRTALKLGPESFKFDGAVE
MAN1A2 Rabbit Polyclonal Antibody
TA378218

USD 220.00

3 Weeks

MAN1A2 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 60-180 of human MAN1A2 (NP_006690.1).
Modifications Unmodified