Antibodies

View as table Download

Rabbit Polyclonal Anti-GTPBP9 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTPBP9 antibody: synthetic peptide directed towards the N terminal of human GTPBP9. Synthetic peptide located within the following region: QGLGNAFLSHISACDGIFHLTRAFEDDDITHVEGSVDPIRDIEIIHEELQ

Rabbit Polyclonal Anti-GTPBP9 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTPBP9 antibody: synthetic peptide directed towards the N terminal of human GTPBP9. Synthetic peptide located within the following region: MIGPIIDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKKPVRFYHDWND

Rabbit Polyclonal Anti-GTPBP9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTPBP9 antibody: synthetic peptide directed towards the N terminal of human GTPBP9. Synthetic peptide located within the following region: GLPNVGKSTFFNVLTNSQASAENFPFCTIDPNESRVPVPDERFDFLCQYH

Rabbit Polyclonal Anti-GTPBP9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTPBP9 antibody: synthetic peptide directed towards the C terminal of human GTPBP9. Synthetic peptide located within the following region: QAAGKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVE

GTPBP9 (OLA1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 42-71 amino acids from the N-terminal region of Human OLA1

OLA1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human OLA1

OLA1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human OLA1

OLA1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human OLA1

OLA1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 297-396 of human OLA1 (NP_037473.3).
Modifications Unmodified