Antibodies

Jump to Filters
View as table Download
OR52W1 Rabbit Polyclonal Antibody
TA316050

USD 345.00

In Stock

Rabbit polyclonal anti-OR52W1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human OR52W1.
OR52W1 Rabbit Polyclonal Antibody
TA332296

USD 375.00

5 Days

Rabbit Polyclonal Anti-OR52W1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR52W1 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR52W1. Synthetic peptide located within the following region: VVELVVGNTQATNLYGLALSLAISGMDILGITGSYGLIAHAVLQLPTREA