Antibodies

Jump to Filters
View as table Download
OSGIN2 Rabbit Polyclonal Antibody
TA342836

USD 375.00

5 Days

Rabbit Polyclonal Anti-OSGIN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OSGIN2 antibody: synthetic peptide directed towards the C terminal of human OSGIN2. Synthetic peptide located within the following region: ECIKEANLFALGPLVGDNFVRFLKGGALGVTRCLATRQKKKHLFVERGGG
OSGIN2 Rabbit Polyclonal Antibody
TA366661

USD 380.00

4 Weeks

OSGIN2 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human OSGIN2
OSGIN2 Rabbit Polyclonal Antibody
TA371012

USD 380.00

4 Weeks

OSGIN2 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human OSGIN2