Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-PTGDR Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | PTGDR / DP antibody was raised against synthetic 20 amino acid peptide from 3rd extracellular domain of human Prostaglandin D2 Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Marmoset (95%); Dog, Pig (85%); Panda, Bovine (80%). |
Rabbit Polyclonal Anti-PTGDR Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | PTGDR / DP antibody was raised against synthetic 20 amino acid peptide from 3rd cytoplasmic domain of human Prostaglandin D2 Receptor. Percent identity with other species by BLAST analysis: Human, Gibbon (100%); Gorilla, Marmoset (95%); Monkey, Panda (85%); Rat, Hamster (80%). |
Rabbit Polyclonal Anti-PTGDR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTGDR antibody: synthetic peptide directed towards the C terminal of human PTGDR. Synthetic peptide located within the following region: FKDVKEKNRTSEEAEDLRALRFLSVISIVDPWIFIIFRSPVFRIFFHKIF |
PTGDR Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
PTGDR Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 220-359 of human PTGDR (NP_000944.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- PTGDR
Antibody Hosts
- Rabbit