Germany
Japan
United Kingdom
China
SIAH3 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 188-217 amino acids from the C-terminal region of Human SIAH3. |
Antibodies
View as table Download
Rabbit polyclonal anti-SIAH3 antibody
| Applications | WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 211 of rat SIAH3 |
Rabbit Polyclonal Anti-SIAH3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SIAH3 antibody is: synthetic peptide directed towards the C-terminal region of Human SIAH3. Synthetic peptide located within the following region: PAPADWIIMHSCLGHHFLLVLRKQERHEGHPQFFATMMLIGTPTQADCFT |
Rabbit Polyclonal Anti-SIAH3 Antibody
| Applications | WB |
| Reactivities | Human, Rabbit, Dog, Horse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SIAH3 antibody is: synthetic peptide directed towards the N-terminal region of Human SIAH3. Synthetic peptide located within the following region: YVSSRRAVTQSAPEQGSFHPHHLSHHHCHHRHHHHLRHHAHPHHLHHQEA |
Active filters
Target Symbol
- SIAH3
Antibody Hosts
- Rabbit