Antibodies

View as table Download

Rabbit Polyclonal antibody to SCAP2 (src kinase associated phosphoprotein 2)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 296 and 359 of SCAP2 (Uniprot ID#O75563)

Rabbit Polyclonal Anti-SKAP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SKAP2 antibody is: synthetic peptide directed towards the middle region of Human SKAP2. Synthetic peptide located within the following region: FEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYSVRMNNTLRKDGKKD

SKAP2 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human SKAP2 (NP_003921.2).
Modifications Unmodified