Antibodies

View as table Download

Rabbit Polyclonal Anti-SLC35C1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC35C1 Antibody: synthetic peptide directed towards the N terminal of human SLC35C1. Synthetic peptide located within the following region: TSISMVFLNKYLLDSPSLRLDTPIFVTFYQCLVTTLLCKGLSALAACCPG

SLC35C1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human SLC35C1