Antibodies

View as table Download

Rabbit monoclonal anti-B3AT antibody for SISCAPA, clone OTIR5D8

Applications SISCAPA
Reactivities Human
Conjugation Unconjugated

SLC4A1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC4A1

Band 3 / AE1 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen SLC4A1 / Band 3 / AE1 antibody was raised against synthetic peptide from human SLC4A1 / Band 3.

Rabbit Polyclonal Anti-SLC4A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC4A1 antibody: synthetic peptide directed towards the N terminal of human SLC4A1. Synthetic peptide located within the following region: PSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGR

Rabbit Polyclonal Anti-SLC4A1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC4A1

SLC4A1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-353 of human SLC4A1 (NP_000333.1).