Antibodies

View as table Download

Rabbit polyclonal SORBS1 Antibody (Center)

Applications IF, WB
Reactivities Human, Hamster
Conjugation Unconjugated
Immunogen This SORBS1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 866-892 amino acids from the Central region of human SORBS1.

Rabbit Polyclonal Anti-Sorbs1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Sorbs1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Sorbs1. Synthetic peptide located within the following region: PQAQQRRVTPDRSQPSLDLCSYQALYSYVPQNDDELELRDGDIVDVMEKC

SORBS1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SORBS1

SORBS1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human SRBS1