Antibodies

View as table Download

Rabbit Polyclonal Spred2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Spred2 antibody was raised against a 13 amino acid peptide near the center of the human Spred2.

Rabbit Polyclonal Anti-SPRED2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SPRED2 antibody: synthetic peptide directed towards the C terminal of human SPRED2. Synthetic peptide located within the following region: NHEENRRGHCQDAPDSVRTCIRRVSCMWCADSMLYHCMSDPEGDYTDPCS

SPRED2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SPRED2