Antibodies

Jump to Filters
View as table Download
STK38L Rabbit Polyclonal Antibody
TA333856

USD 375.00

5 Days

Rabbit Polyclonal Anti-STK38L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-STK38L Antibody: synthetic peptide directed towards the middle region of human STK38L. Synthetic peptide located within the following region: PAAIPIEIKSIDDTSNFDDFPESDILQPVPNTTEPDYKSKDWVFLNYTYK
STK38L Rabbit Polyclonal Antibody
TA382138

USD 220.00

3 Weeks

STK38L Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 165-464 of human STK38L (NP_055815.1).
Modifications Unmodified