Rabbit Polyclonal Anti-SR140 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SR140 antibody: synthetic peptide directed towards the N terminal of human SR140. Synthetic peptide located within the following region: NLSRPLLENKLKAFSIGKMSTAKRTLSKKEQEELKKKEDEKAAAEIYEEF |
Rabbit Polyclonal Anti-SR140 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SR140 antibody: synthetic peptide directed towards the middle region of human SR140. Synthetic peptide located within the following region: KVAPSKWEAVDESELEAQAVTTSKWELFDQHEESEEEENQNQEEESEDEE |
U2SURP Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human SR140 |
U2SURP Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 705-1029 of human U2SURP (NP_001073884.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China