Antibodies

Jump to Filters
View as table Download
SMYD3 Rabbit Polyclonal Antibody
TA339750

USD 375.00

5 Days

Rabbit Polyclonal Anti-SMYD3 Antibody

Applications 10k-ChIP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SMYD3 antibody: synthetic peptide directed towards the N terminal of human SMYD3. Synthetic peptide located within the following region: PRYPPDSVRLLGRVVFKLMDGAPSESEKLYSFYDLESNINKLTEDKKEGL