Antibodies

Jump to Filters
View as table Download
HDAC1 Rabbit Polyclonal Antibody
TA347134

USD 545.00

5 Days

Rabbit Polyclonal HDAC1 Antibody

Applications Assay, ELISA, IF, WB
Reactivities Human
Immunogen The immunogen for anti-HDAC1 antibody: the C-terminal region of human HDAC1 (Histone deacetylase 1), using a KLH-conjugated synthetic peptide.
POLR2A Mouse Monoclonal Antibody
TA347267

USD 450.00

5 Days

Mouse Monoclonal Pol II Antibody

Applications Assay, ELISA, IF, WB
Reactivities Human
POLR2A Mouse Monoclonal Antibody
TA347268

USD 450.00

5 Days

Mouse Monoclonal Pol II S2p Antibody

Applications Assay, ELISA, IF, WB
Reactivities Human
POLR2A Mouse Monoclonal Antibody
TA347269

USD 450.00

5 Days

Mouse Monoclonal Pol II S5p Antibody

Applications Assay, ELISA, IF, WB
Reactivities Human
p53 (TP53) Rabbit Polyclonal Antibody
TA329140

USD 375.00

5 Days

Rabbit Polyclonal anti-TP53 antibody

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE
p53 (TP53) Rabbit Polyclonal Antibody
TA329141

USD 375.00

5 Days

Rabbit Polyclonal anti-TP53 antibody

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE
HDAC2 Rabbit Polyclonal Antibody
TA329701

USD 375.00

5 Days

Rabbit Polyclonal Anti-HDAC2 Antibody

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HDAC2 antibody: synthetic peptide directed towards the middle region of human HDAC2. Synthetic peptide located within the following region: HKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSN
HDAC2 Rabbit Polyclonal Antibody
TA330629

USD 375.00

5 Days

Rabbit Polyclonal Anti-HDAC2 Antibody

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HDAC2 antibody: synthetic peptide directed towards the middle region of human HDAC2. Synthetic peptide located within the following region: HKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSN
p53 (TP53) Mouse Monoclonal Antibody
TA329634

USD 330.00

5 Days

Mouse Monoclonal anti-TP53 Antibody

Applications Assay, WB
Reactivities Human
Conjugation Unconjugated
p53 (TP53) Mouse Monoclonal Antibody
TA329635

USD 330.00

5 Days

Mouse Monoclonal anti-TP53 Antibody

Applications Assay, WB
Reactivities Human
Conjugation Unconjugated
p53 (TP53) Mouse Monoclonal Antibody
TA329636

USD 330.00

5 Days

Mouse Monoclonal anti-TP53 Antibody

Applications Assay, WB
Reactivities Human
Conjugation Unconjugated