Antibodies

Jump to Filters
View as table Download
SNF2H (SMARCA5) Rabbit Polyclonal Antibody
TA329651

USD 375.00

5 Days

Rabbit Polyclonal anti-SMARCA5 antibody

Applications Assay, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SMARCA5 antibody: synthetic peptide directed towards the N terminal of human SMARCA5. Synthetic peptide located within the following region: AGPADAEMEEIFDDASPGKQKEIQEPDPTYEEKMQTDRANRFEYLLKQTE