Antibodies

Jump to Filters
View as table Download
CTCF Rabbit Polyclonal Antibody
TA330058

USD 375.00

5 Days

Rabbit Polyclonal Anti-CTCF Antibody

Applications Assay, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTCF antibody: synthetic peptide directed towards the N terminal of human CTCF. Synthetic peptide located within the following region: GELPPQEDPSWQKDPDYQPPAKKTKKTKKSKLRYTEEGKDVDVSVYDFEE