Antibodies

Jump to Filters
View as table Download
p53 (TP53) Rabbit Polyclonal Antibody
TA329142

USD 375.00

5 Days

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP
p53 (TP53) Rabbit Polyclonal Antibody
TA329146

USD 375.00

5 Days

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE
p53 (TP53) Rabbit Polyclonal Antibody
TA321153

USD 345.00

In Stock

Anti-TP53 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 1-233 amino acids of human tumor protein p53
p53 (TP53) Rabbit Polyclonal Antibody
TA385443

USD 380.00

4 Weeks

Acetyl-p53 (Lys382) Rabbit polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthesized acetyl-peptide derived from the human p53 around the acetylation site of K382. (Acetylated)
p53 (TP53) Rabbit Polyclonal Antibody
TA385444

USD 380.00

4 Weeks

Phospho-p53 (Ser15) Rabbit polyclonal Antibody

Applications ELISA, IF, IHC, IP, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human p53 around the phosphorylation site of Ser15. AA range:1-50 (Phosphorylated)
p53 (TP53) Rabbit Polyclonal Antibody
TA385445

USD 380.00

4 Weeks

p53 Rabbit polyclonal Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human p53. AA range:10-59
p53 (TP53) Mouse Monoclonal Antibody [Clone ID: PAb421]
TA385747

USD 523.00

2 Weeks

Recombinant Anti-p53 (Clone PAb421)

Applications ELISA, IF, IHC, IP, WB
Reactivities Human, Monkey, Mouse, Rabbit, Rat
Conjugation Unconjugated
p53 (TP53) Rabbit Monoclonal Antibody [Clone ID: PAb421]
TA385748

USD 523.00

2 Weeks

Recombinant Anti-p53 (Clone PAb421)

Applications ELISA, IF, IHC, IP, WB
Reactivities Human, Monkey, Mouse, Rabbit, Rat
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG2a format, for improved compatibility with existing reagents, assays and techniques.