Rabbit Polyclonal Anti-ADD3 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADD3 antibody: synthetic peptide directed towards the C terminal of human ADD3. Synthetic peptide located within the following region: DELAKRVSRLSTSTTIENIEITIKSPEKIEEVLSPEGSPSKSPSKKKKKF |
Rabbit Polyclonal Anti-ADD3 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADD3 antibody: synthetic peptide directed towards the middle region of human ADD3. Synthetic peptide located within the following region: AYYDYQGSLEEQEERIQLQKVLGPSCKVLVLRNHGVVALGETLEEAFHYI |
Germany
Japan
United Kingdom
China
