Antibodies

Jump to Filters
View as table Download
EDF1 Rabbit Polyclonal Antibody
TA343423

USD 375.00

5 Days

Rabbit Polyclonal Anti-EDF1 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EDF1 antibody: synthetic peptide directed towards the middle region of human EDF1. Synthetic peptide located within the following region: INEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRAK
EDF1 Rabbit Polyclonal Antibody
TA339083

USD 375.00

5 Days

Rabbit Polyclonal Anti-EDF1 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EDF1 antibody: synthetic peptide directed towards the N terminal of human EDF1. Synthetic peptide located within the following region: MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNK