Antibodies

Jump to Filters
View as table Download
USP15 Rabbit Polyclonal Antibody
TA308738

USD 415.00

2 Weeks

Rabbit Polyclonal antibody to USP15 (ubiquitin specific peptidase 15)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 920 and 981 of USP15 (Uniprot ID#Q9Y4E8)
USP15 Rabbit Polyclonal Antibody
TA342568

USD 375.00

5 Days

Rabbit Polyclonal Anti-USP15 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-USP15 antibody: synthetic peptide directed towards the C terminal of human USP15. Synthetic peptide located within the following region: GNTDINYIKDDTRHIRFDDRQLRLDERSFLALDWDPDLKKRYFDENAAED
USP15 Rabbit Polyclonal Antibody
TA383146

USD 220.00

3 Weeks

USP15 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 852-952 of human USP15 (NP_006304.1).
Modifications Unmodified