Rabbit Polyclonal Anti-HNRPL Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPL antibody: synthetic peptide directed towards the N terminal of human HNRPL. Synthetic peptide located within the following region: AAGGGGGGENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYV |
HNRNPL Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 282-589 of human HNRNPL (NP_001524.2). |
| Modifications | Unmodified |
HNRNPL Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 282-589 of human HNRNPL (NP_001524.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
