Rabbit Polyclonal Anti-BRD4 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BRD4 antibody: synthetic peptide directed towards the C terminal of human BRD4. Synthetic peptide located within the following region: EIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSS |
BRD4 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 700-794 of human BRD4 (NP_001317313.1). |
Recombinant Anti-BRD4 (Clone RAB-C131)
| Applications | ChIP, ELISA, FC, IF |
| Reactivities | Human |
| Conjugation | His Tag |
Recombinant Anti-BRD4 (Clone RAB-C131)
| Applications | ChIP, ELISA, FC, IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Human Fab format, for improved compatibility with existing reagents, assays and techniques. |
Germany
Japan
United Kingdom
China
