BMP2 (aa 261-290) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 261-290 of Human BMP2. |
BMP2 (aa 261-290) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 261-290 of Human BMP2. |
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
Rabbit Polyclonal Anti-WNT3A Antibody - N-terminal region
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT3A antibody: synthetic peptide directed towards the N terminal of human WNT3A. Synthetic peptide located within the following region: MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP |
Rabbit Polyclonal BMP-2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of human BMP2 (within residues 250-350) [Swiss-Prot# P12643] |
WNT8A Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Bat, Gibbon, Gorilla, Horse, Human, Monkey |
Conjugation | Unconjugated |
Immunogen | WNT8A antibody was raised against synthetic 14 amino acid peptide from internal region of human WNT8A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bat, Elephant, Panda, Horse (100%); Bovine, Dog (93%); Rabbit (86%). |
Anti-Human BMP-2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human BMP-2 |
Anti-Human WNT-3a Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived recombinant Human WNT-3a. |
Rabbit Polyclonal Anti-WNT8A Antibody (Internal)
Applications | IHC |
Reactivities | Human |
Immunogen | WNT8A antibody was raised against synthetic 14 amino acid peptide from internal region of human WNT8A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (93%); Bat, Dog, Bovine, Horse, Rabbit (86%). |
Rabbit Polyclonal Anti-WNT3A Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human WNT3A |
Rabbit Polyclonal Anti-WNT8A Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human WNT8A |