Antibodies

View as table Download

Rabbit Polyclonal Anti-MAFB Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAFB antibody: synthetic peptide directed towards the N terminal of human MAFB. Synthetic peptide located within the following region: MAAELSMGPELPTSPLAMEYVNDFDLLKFDVKKEPLGRAERPGRPCTRLQ

Rabbit Polyclonal Anti-MAFB Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-MAFB antibody: synthetic peptide directed towards the N terminal of human MAFB. Synthetic peptide located within the following region: RPGRPCTRLQPAGSVSSTPLSTPCSSVPSSPSFSPTEQKTHLEDLYWMAS

Carrier-free (BSA/glycerol-free) MAFB mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MAFB mouse monoclonal antibody, clone OTI1E9 (formerly 1E9)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MAFB mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MAFB mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MAFB mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

MAFB mouse monoclonal antibody, clone OTI1E9 (formerly 1E9)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MAFB mouse monoclonal antibody,clone 1E9, Biotinylated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

MAFB mouse monoclonal antibody,clone 1E9, HRP conjugated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

MAFB mouse monoclonal antibody, clone OTI1E9 (formerly 1E9)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

MAFB mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MAFB mouse monoclonal antibody,clone 2A6, Biotinylated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

MAFB mouse monoclonal antibody,clone 2A6, HRP conjugated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

MAFB mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".