Rabbit Polyclonal antibody to CBS (cystathionine-beta-synthase)
Applications | IF, IHC, IP, WB |
Reactivities | Human |
Immunogen | Recombinant fragment corresponding to a region within amino acids 39 and 251 of CBS (Uniprot ID#P35520) |
Rabbit Polyclonal antibody to CBS (cystathionine-beta-synthase)
Applications | IF, IHC, IP, WB |
Reactivities | Human |
Immunogen | Recombinant fragment corresponding to a region within amino acids 39 and 251 of CBS (Uniprot ID#P35520) |
Rabbit Polyclonal Anti-CBS Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | The immunogen for anti-CBS antibody: synthetic peptide directed towards the N terminal of human CBS. Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE |
Rabbit Polyclonal Anti-MAT1A Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAT1A antibody: synthetic peptide directed towards the N terminal of human MAT1A. Synthetic peptide located within the following region: TSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGE |
Rabbit Polyclonal antibody to WBSCR22 (Williams Beuren syndrome chromosome region 22)
Applications | IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 263 of WBSCR22 (Uniprot ID#O43709) |
GGT1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GGT1 |
Rabbit Polyclonal Anti-LCMT1 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human LCMT1 |
Rabbit polyclonal antibody to Selenophosphate synthetase 1 (selenophosphate synthetase 1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 204 of Selenophosphate synthetase 1 (Uniprot ID#P49903) |
Rabbit Polyclonal antibody to AHCYL2 (adenosylhomocysteinase-like 2)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 298 and 578 of AHCYL2 (Uniprot ID#Q96HN2) |
Rabbit Polyclonal TYW4 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TYW4 antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human TYW4. |
Rabbit Polyclonal Anti-CTH Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CTH antibody: synthetic peptide directed towards the C terminal of human CTH. Synthetic peptide located within the following region: ESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLK |
Rabbit Polyclonal antibody to GGT1 (gamma-glutamyltransferase 1)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 226 of GGT1 (Uniprot ID#P19440) |
Rabbit Polyclonal Anti-PAPSS1 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PAPSS1 |
Rabbit Polyclonal Anti-CBS Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CBS |
Rabbit Polyclonal Anti-GGT1 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GGT1 |