Antibodies

View as table Download

Rabbit Polyclonal Anti-DCXR Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DCXR antibody: synthetic peptide directed towards the middle region of human DCXR. Synthetic peptide located within the following region: STKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKAKTM

Goat Polyclonal Antibody against DCXR

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence GSTLPVEGGFWAC, from the C Terminus of the protein sequence according to NP_057370.1.

Carrier-free (BSA/glycerol-free) DCXR mouse monoclonal antibody, clone OTI7D11 (formerly 7D11)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) DCXR mouse monoclonal antibody, clone OTI4D11 (formerly 4D11)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) DCXR mouse monoclonal antibody, clone OTI9C9 (formerly 9C9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-DCXR mouse monoclonal antibody, clone OTI7D11 (formerly 7D11)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-DCXR mouse monoclonal antibody, clone OTI7D11 (formerly 7D11)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-DCXR mouse monoclonal antibody, clone OTI4D11 (formerly 4D11)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-DCXR mouse monoclonal antibody, clone OTI4D11 (formerly 4D11)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-DCXR mouse monoclonal antibody, clone OTI9C9 (formerly 9C9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-DCXR mouse monoclonal antibody, clone OTI9C9 (formerly 9C9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated