Antibodies

View as table Download

Rabbit Polyclonal Anti-BRK1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C3orf10 antibody: synthetic peptide directed towards the middle region of human C3orf10. Synthetic peptide located within the following region: YIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTK

Rabbit Polyclonal Anti-BRK1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human BRK1