Rabbit Polyclonal Anti-DFNA5 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DFNA5 antibody: synthetic peptide directed towards the C terminal of human DFNA5. Synthetic peptide located within the following region: AALLGTCCKLQIIPTLCHLLRALSDDGVSDLEDPTLTPLKDTERFGIVQR |
GSDME rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GSDME |
DFNA5/GSDME Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human DFNA5/GSDME (NP_004394.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
