Antibodies

Jump to Filters
View as table Download
HOXC8 Rabbit Polyclonal Antibody
TA345364

USD 475.00

5 Days

Rabbit Polyclonal Anti-HOXC8 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HOXC8 antibody: synthetic peptide directed towards the N terminal of human HOXC8. Synthetic peptide located within the following region: SHALVYGPGGSAPGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGD
HOXC8 Rabbit Polyclonal Antibody
TA322194

USD 345.00

In Stock

Anti-HOXC8 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 98-107 amino acids of Human homeobox C8
HOXC8 Rabbit Polyclonal Antibody
TA366813

USD 380.00

4 Weeks

HOXC8 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human HOXC8